PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.3G045800.1.p
Common NameLOC101770505, SETIT_024430mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family LBD
Protein Properties Length: 211aa    MW: 21796.7 Da    PI: 6.698
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.3G045800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.87.6e-43361351100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrr+C++ Cvlapyfp ++p+kfa +h++FGasn++kll++lpee+r da+ss+vyeA ar+rdPvyG++g i +lq+q++ lk
  Seita.3G045800.1.p  36 PCAACKILRRRCVDRCVLAPYFPPTEPHKFATAHRVFGASNIIKLLQDLPEEHRADAVSSMVYEASARIRDPVYGCAGAICQLQRQVNDLK 126
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                         a+la++++e
  Seita.3G045800.1.p 127 AQLARAHAE 135
                         *****9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.04935136IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-4236133IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MDSSSSDTTA TAALPHGGGA STAPTSPPAA AVVLSPCAAC KILRRRCVDR CVLAPYFPPT  60
EPHKFATAHR VFGASNIIKL LQDLPEEHRA DAVSSMVYEA SARIRDPVYG CAGAICQLQR  120
QVNDLKAQLA RAHAELAGAR AQHAHLLALL CVEVAAASPA YCGAVDYTSS QLAAAATPAA  180
HADALYVVDG GSGLQLQASP VSWADEPLWT *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0790217e-77AC079021.5 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone P0008A07, complete sequence.
GenBankAC0930897e-77AC093089.1 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OJ1729_E02, complete sequence.
GenBankAP0149617e-77AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
GenBankCP0126137e-77CP012613.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004960340.11e-150PREDICTED: LOB domain-containing protein 1
SwissprotQ9SK083e-62LBD11_ARATH; LOB domain-containing protein 11
TrEMBLK3ZCZ91e-150K3ZCZ9_SETIT; Uncharacterized protein
STRINGSi024430m1e-150(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26453790
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.12e-46LOB domain-containing protein 1